PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_019704-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 273aa    MW: 30730.6 Da    PI: 9.7804
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_019704-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-18134188256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++k q+ +Le++F+++ +++++++ eLAk+++L  rqV vWFqNrRa+ k
  AHYPO_019704-RA 134 RKKLRLSKAQIMVLEQAFREHTTLNTKQKMELAKQVHLRPRQVEVWFQNRRARTK 188
                      778899***********************************************98 PP

2HD-ZIP_I/II115.14.2e-37134223191
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                      +kk+rlsk q+ +LE+ F+e+++L++++K+ela++++l+prqv+vWFqnrRARtk+kq+E+d+e+L++ +++l+een++Lekev++Lr +l
  AHYPO_019704-RA 134 RKKLRLSKAQIMVLEQAFREHTTLNTKQKMELAKQVHLRPRQVEVWFQNRRARTKLKQIEVDCEYLRSYCEKLREENKKLEKEVQQLR-AL 223
                      69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.55E-19113191IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-19116188IPR009057Homeodomain-like
PROSITE profilePS5007117.443130190IPR001356Homeobox domain
SMARTSM003892.0E-15132194IPR001356Homeobox domain
PfamPF000465.6E-16134188IPR001356Homeobox domain
CDDcd000868.23E-15134191No hitNo description
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
PfamPF021831.0E-8190224IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.4E-16190233IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MAQEINHEFW GMSLSLKPPI THLDHHKPII CKREPQILTD EEKPKKQKAN YEKAIMMVPK  60
INNIGIEIKP PLVVDLEDLE ITSKVIVSPN STLSSTATGK HLGGYKFNGG QMMSDEDEGG  120
NGGGSCGGDR SGDRKKLRLS KAQIMVLEQA FREHTTLNTK QKMELAKQVH LRPRQVEVWF  180
QNRRARTKLK QIEVDCEYLR SYCEKLREEN KKLEKEVQQL RALKASASHH PPTTLATCPS  240
CISSSTPVAQ TTPSPCSLPI LYRPPPLYKL RK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182190RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692080.11e-92PREDICTED: homeobox-leucine zipper protein HAT3
SwissprotP466023e-52HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A0J8EA681e-92A0A0J8EA68_BETVU; Uncharacterized protein
STRINGfgenesh2_kg.4__2679__AT2G44910.12e-52(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.12e-40homeobox-leucine zipper protein 3